PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G033912.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family BBR-BPC
Protein Properties Length: 339aa    MW: 38292.4 Da    PI: 10.118
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G033912.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind347.82.4e-106203381301
             GAGA_bind   1 mdddgsre..rnkg.yye..............pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaern 71 
                           mdd  ++e  r+k  yy+              ++ ++l   +++++ms+iaerda+irern+a+sek++a+aerd+a  qrd+ +a+r+
  HL.SW.v1.0.G033912.1  20 MDDGRHHEtsRHKVdYYRashspwnmmaphqvKEpNALV--MNKKIMSIIAERDAAIRERNAAVSEKNEALAERDEARRQRDEVMAQRD 106
                           777777767799998999999999999987663346676..99********************************************** PP

             GAGA_bind  72 kalverdnkllalllvenslasalpvgvqvlsgtksidslqqlse......pqledsavelreeeklealpieeaaeeakekkkkkkrq 154
                            al+erdn+l+al++++ns++ +l+   +v +g+k +++    +       +  ++++++ +e+++++a+pi+   ++a +++++k+ +
  HL.SW.v1.0.G033912.1 107 SALMERDNALAALQVRNNSMNATLS--GGVQRGVKRMNHPSV-HMpnmalaTYDSKDTYDSKEMQITDAFPITVISSDAIKSRQTKRPK 192
                           ******************9886654..445566666665554.3312232233345566678888888888877777777766666444 PP

             GAGA_bind 155 rakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyP 243
                            +k   ++++k ++kk  ++  + ++ s+ ++ ++e++s+d++ln +++Dest+PvPvCsCtGa rqCYkWG+GGWqS+CCtt++S+yP
  HL.SW.v1.0.G033912.1 193 VNKGHSTRESKPPRKKV-AEDLNRRATSDGTKYRTEWDSQDVGLNLITFDESTMPVPVCSCTGAARQCYKWGSGGWQSSCCTTNMSMYP 280
                           44433333333333322.22222333333378********************************************************* PP

             GAGA_bind 244 LPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                           LP+ +++r+aR++grKmS+++f++lL++Laa+G+dls p+DL+++WA+HGtn+++ti+
  HL.SW.v1.0.G033912.1 281 LPQIPNKRHARMGGRKMSGSVFTRLLSRLAAQGHDLSMPLDLREYWARHGTNRYITIK 338
                           *********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062177.4E-9820338IPR010409GAGA-binding transcriptional activator
SMARTSM012263.4E-13820338IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDMRVGHSEP LLRQLGCNTM DDGRHHETSR HKVDYYRASH SPWNMMAPHQ VKEPNALVMN  60
KKIMSIIAER DAAIRERNAA VSEKNEALAE RDEARRQRDE VMAQRDSALM ERDNALAALQ  120
VRNNSMNATL SGGVQRGVKR MNHPSVHMPN MALATYDSKD TYDSKEMQIT DAFPITVISS  180
DAIKSRQTKR PKVNKGHSTR ESKPPRKKVA EDLNRRATSD GTKYRTEWDS QDVGLNLITF  240
DESTMPVPVC SCTGAARQCY KWGSGGWQSS CCTTNMSMYP LPQIPNKRHA RMGGRKMSGS  300
VFTRLLSRLA AQGHDLSMPL DLREYWARHG TNRYITIK*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095680.10.0hypothetical protein L484_012253
SwissprotQ8S8C61e-131BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLW9R7S80.0W9R7S8_9R
STRINGGLYMA05G38430.21e-162(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69743348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-122basic pentacysteine 4